PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10001664
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family NAC
Protein Properties Length: 412aa    MW: 45702.8 Da    PI: 6.2626
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10001664genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.21.1e-51161441128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                  +ppGfrFhPt+eel+++yL+kkv+++k++l +vi+evd++k+ePwd+++++k     +++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk ++s 
  Lus10001664  16 VPPGFRFHPTEEELLHYYLRKKVASDKIDL-DVIREVDLNKLEPWDIQERCKIgstPQNDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKIIYS- 111
                  69****************************.9***************964444222455**************************************. PP

          NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                  + + +gl+ktLvfykgrap+g+k+dW+mheyrl
  Lus10001664 112 GARRIGLRKTLVFYKGRAPHGQKSDWIMHEYRL 144
                  999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.84E-5612188IPR003441NAC domain
PROSITE profilePS5100555.44416188IPR003441NAC domain
PfamPF023652.6E-2717144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009809Biological Processlignin biosynthetic process
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0010047Biological Processfruit dehiscence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MRSEHVNLSV NGQSKVPPGF RFHPTEEELL HYYLRKKVAS DKIDLDVIRE VDLNKLEPWD  60
IQERCKIGST PQNDWYFFSH KDKKYPTGTR TNRATAAGFW KATGRDKIIY SGARRIGLRK  120
TLVFYKGRAP HGQKSDWIMH EYRLDDAAPA PFDTINSNPG MMVMMSNVVI GDQLGSEEGW  180
VVCRVFKKKN YQKTLDSPKL SSHVADSKPH ILMSSLSTAA ARYGTESSTT DGVLDQILMY  240
MGGRNGLTST SNCSIGATGT STGYCKAESD YLFHLPRLVA DHEQLQLSQS FGGGGDAMVT  300
SDDNNNNDNC NRFDVTAGSK GGMMVVNDWA ALDRLVASQL NGHLHHGHQD DVVEDDDDDV  360
DDQFRSMPNH HYEQQLMYGG GGESDNDVWT NFTKSSSSPS SSSDPLCHLS V*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-4711903170Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00016PBMTransfer from AT1G32770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ6934293e-74JQ693429.1 Brachypodium distachyon SWN8 (SWN8) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002518924.11e-136PREDICTED: NAC domain-containing protein 43
SwissprotQ9LPI71e-116NAC12_ARATH; NAC domain-containing protein 12
TrEMBLB9RYV51e-136B9RYV5_RICCO; NAC domain-containing protein, putative
STRINGPOPTR_0001s45250.11e-131(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30313374
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32770.11e-106NAC domain containing protein 12